Mol Scientific
  1. Companies
  2. Mol Scientific
  3. Products
  4. Mol Scientific - Model MPE0009794 - ...

Mol ScientificModel MPE0009794 - Crustacean hyperglycemic hormone precursor related peptide CPRP

SHARE
Mol Scientific offer high-quality Crustacean hyperglycemic hormone precursor related peptide CPRP product(MPE0009794). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches

Brand: Mol Scientific
Product Name: Crustacean hyperglycemic hormone precursor related peptide CPRP
Cat #: MPE0009794
Molecular Formula:
Molecular Weight:RSAQGYGHMDKLLQSLRGNGDPTTPIDNMAHSLE
Three letter code:Arg-Ser-Ala-Gln-Gly-Tyr-Gly-His-Met-Asp-Lys-Leu-Leu-Gln-Ser-Leu-Arg-Gly-Asn-Gly-Asp-Pro-Thr-Thr-Pro-Ile-Asp-Asn-Met-Ala-His-Ser-Leu-Glu
Peptide Purity (HPLC):
Quantity/Unit:1 Vial