Companies
Aviva Systems Biology Corporation
Products
Model ARP42247_T100 - SLC1A5 Antibody - ...

Model ARP42247_T100 -SLC1A5 Antibody - Middle Region

FromAviva Systems Biology Corporation

SHARE

Tested Species Reactivity : Human, Cow. Predicted Species Reactivity : Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish. Product Format : Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Clonality : Polyclonal. Host : Rabbit. Application : IHC, WB.

Most popular related searches

sheep production

pig productivity

Reconstitution and Storage : For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen : The immunogen is a synthetic peptide directed towards the middle region of human SLC1A5
Purification : Protein A purified
Predicted Homology Based on Immunogen Sequence : Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Peptide Sequence : Synthetic peptide located within the following region: FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV
Concentration : 1.0 mg/ml
Blocking Peptide : For anti-SLC1A5 (ARP42247_T100) antibody is Catalog # AAP42247 (Previous Catalog # AAPP24670)
Sample Type Confirmation :
SLC1A5 is supported by BioGPS gene expression data to be expressed in Jurkat