Logo Agriculture XPRT
Companies
Products
Services
Software
Training
Applications
Sign in
List your business
Aviva Systems Biology Corporation
About
  2. Companies
  3. Aviva Systems Biology Corporation
  4. Products
  5. Model ARP49203_P050 - POLQ Antibody - ...

Model ARP49203_P050 -POLQ Antibody - C-terminal Region

SHARE

Tested Species Reactivity : Human. Predicted Species Reactivity : Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit. Product Format : Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Clonality : Polyclonal. Host : Rabbit. Application : WB.

Most popular related searches
horse
horse product
pig productivity
pig production
  • Reconstitution and Storage : For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
  • Immunogen : The immunogen is a synthetic peptide directed towards the C terminal region of human POLQ
  • Purification : Affinity Purified
  • Predicted Homology Based on Immunogen Sequence : Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100%
  • Peptide Sequence : Synthetic peptide located within the following region: GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL
  • Concentration : 0.5 mg/ml
  • Blocking Peptide : For anti-POLQ (ARP49203_P050) antibody is Catalog # AAP49203 (Previous Catalog # AAPS24206)