Mol Scientific
  1. Companies
  2. Mol Scientific
  3. Products
  4. Mol Scientific - Model MPE0006971 - ...

Mol ScientificModel MPE0006971 -Pheromone-biosynthesis-activating neuropeptide

SHARE
Mol Scientific offer high-quality Pheromone-biosynthesis-activating neuropeptide product(MPE0006971). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches

Brand: Mol Scientific
Product Name: Pheromone-biosynthesis-activating neuropeptide
Cat #: MPE0006971
Molecular Formula:C173H270N50O57S
Molecular Weight:RLADDTPATPADQEMYRPEPEQIDSRTKYFSPRL
Three letter code:H-Arg-Leu-Ala-Asp-Asp-Thr-Pro-Ala-Thr-Pro-Ala-Asp-Gln-Glu-Met-Tyr-Arg-Pro-Glu-Pro-Glu-Gln-Ile-Asp-Ser-Arg-Thr-Lys-Tyr-Phe-Ser-Pro-Arg-Leu-NH2
Peptide Purity (HPLC):
Quantity/Unit:1 Vial